Anti LCN9 pAb (ATL-HPA060941)

Atlas Antibodies

Catalog No.:
ATL-HPA060941-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lipocalin 9
Gene Name: LCN9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023210: 56%, ENSRNOG00000027821: 48%
Entrez Gene ID: 392399
Uniprot ID: Q8WX39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQ
Gene Sequence AQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQ
Gene ID - Mouse ENSMUSG00000023210
Gene ID - Rat ENSRNOG00000027821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LCN9 pAb (ATL-HPA060941)
Datasheet Anti LCN9 pAb (ATL-HPA060941) Datasheet (External Link)
Vendor Page Anti LCN9 pAb (ATL-HPA060941) at Atlas Antibodies

Documents & Links for Anti LCN9 pAb (ATL-HPA060941)
Datasheet Anti LCN9 pAb (ATL-HPA060941) Datasheet (External Link)
Vendor Page Anti LCN9 pAb (ATL-HPA060941)