Anti LCN9 pAb (ATL-HPA060941)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060941-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LCN9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023210: 56%, ENSRNOG00000027821: 48%
Entrez Gene ID: 392399
Uniprot ID: Q8WX39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQ |
Gene Sequence | AQEFDPHTVMQRNYNVARVSGVWYSIFMASDDLNRIKENGDLRVFVRNIEHLKNGSLIFDFEYMVQ |
Gene ID - Mouse | ENSMUSG00000023210 |
Gene ID - Rat | ENSRNOG00000027821 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LCN9 pAb (ATL-HPA060941) | |
Datasheet | Anti LCN9 pAb (ATL-HPA060941) Datasheet (External Link) |
Vendor Page | Anti LCN9 pAb (ATL-HPA060941) at Atlas Antibodies |
Documents & Links for Anti LCN9 pAb (ATL-HPA060941) | |
Datasheet | Anti LCN9 pAb (ATL-HPA060941) Datasheet (External Link) |
Vendor Page | Anti LCN9 pAb (ATL-HPA060941) |