Anti LCLAT1 pAb (ATL-HPA049217)

Atlas Antibodies

Catalog No.: ATL-HPA049217-25

Protein Description: lysocardiolipin acyltransferase 1
Gene Name: LCLAT1
Alternative Gene Name: AGPAT8, ALCAT1, FLJ37965, LYCAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054469: 90%, ENSRNOG00000034026: 89%
Entrez Gene ID: 253558
Uniprot ID: Q6UWP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYV
• Gene Sequence: ICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKSHFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYV
• Gene ID - Mouse: ENSMUSG00000054469
• Gene ID - Rat: ENSRNOG00000034026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.