Anti LCA5 pAb (ATL-HPA029055)

Atlas Antibodies

Catalog No.:
ATL-HPA029055-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Leber congenital amaurosis 5
Gene Name: LCA5
Alternative Gene Name: C6orf152
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032258: 67%, ENSRNOG00000009580: 66%
Entrez Gene ID: 167691
Uniprot ID: Q86VQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSGNVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASG
Gene Sequence NSGNVRSPASPNEFAFGSYVPSFAKTSERSNPFSQKSSFLDFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASG
Gene ID - Mouse ENSMUSG00000032258
Gene ID - Rat ENSRNOG00000009580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LCA5 pAb (ATL-HPA029055)
Datasheet Anti LCA5 pAb (ATL-HPA029055) Datasheet (External Link)
Vendor Page Anti LCA5 pAb (ATL-HPA029055) at Atlas Antibodies

Documents & Links for Anti LCA5 pAb (ATL-HPA029055)
Datasheet Anti LCA5 pAb (ATL-HPA029055) Datasheet (External Link)
Vendor Page Anti LCA5 pAb (ATL-HPA029055)