Anti-LCA5 pAb (ATL-HPA029054)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029054-100
- Shipping:
- Calculated at Checkout
$596.00
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HQAPRKPSPKGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQL |
| Gene Sequence | HQAPRKPSPKGLPNRKGVRVGFRSQSLNREPLRKDTDLVTKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQL |
| Gene ID - Mouse | ENSMUSG00000032258 |
| Gene ID - Rat | ENSRNOG00000009580 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-LCA5 pAb (ATL-HPA029054) | |
| Vendor Page | Anti-LCA5 pAb (ATL-HPA029054) at Atlas Antibodies |
| Documents & Links for Anti-LCA5 pAb (ATL-HPA029054) | |
| Vendor Page | Anti-LCA5 pAb (ATL-HPA029054) |