Anti LBR pAb (ATL-HPA049840 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049840-25

• 

Protein Description: lamin B receptor
Gene Name: LBR
Alternative Gene Name: DHCR14B, TDRD18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004880: 87%, ENSRNOG00000052574: 89%
Entrez Gene ID: 3930
Uniprot ID: Q14739
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS
• Gene Sequence: MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS
• Gene ID - Mouse: ENSMUSG00000004880
• Gene ID - Rat: ENSRNOG00000052574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.