Anti LBR pAb (ATL-HPA049840 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049840-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: lamin B receptor
Gene Name: LBR
Alternative Gene Name: DHCR14B, TDRD18
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004880: 87%, ENSRNOG00000052574: 89%
Entrez Gene ID: 3930
Uniprot ID: Q14739
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS
Gene Sequence MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSSS
Gene ID - Mouse ENSMUSG00000004880
Gene ID - Rat ENSRNOG00000052574
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LBR pAb (ATL-HPA049840 w/enhanced validation)
Datasheet Anti LBR pAb (ATL-HPA049840 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LBR pAb (ATL-HPA049840 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LBR pAb (ATL-HPA049840 w/enhanced validation)
Datasheet Anti LBR pAb (ATL-HPA049840 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LBR pAb (ATL-HPA049840 w/enhanced validation)