Anti LBP pAb (ATL-HPA001508)

Atlas Antibodies

Catalog No.: ATL-HPA001508-25

Protein Description: lipopolysaccharide binding protein
Gene Name: LBP
Alternative Gene Name: BPIFD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016024: 65%, ENSRNOG00000014532: 66%
Entrez Gene ID: 3929
Uniprot ID: P18428
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYI
• Gene Sequence: EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYI
• Gene ID - Mouse: ENSMUSG00000016024
• Gene ID - Rat: ENSRNOG00000014532
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LBP pAb (ATL-HPA001508) – 2 Found

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. 

Cai, Quan-Yu; Jiang, Jing-Hua; Jin, Ri-Ming; Jin, Guang-Zhi; Jia, Ning-Yang. The clinical significance of lipopolysaccharide binding protein in hepatocellular carcinoma. Oncology Letters. 2020;19(1):159-166.