Anti LBH pAb (ATL-HPA034669)

Atlas Antibodies

Catalog No.: ATL-HPA034669-25

Protein Description: limb bud and heart development
Gene Name: LBH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024063: 92%, ENSRNOG00000039902: 93%
Entrez Gene ID: 81606
Uniprot ID: Q53QV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKE
• Gene Sequence: PDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKE
• Gene ID - Mouse: ENSMUSG00000024063
• Gene ID - Rat: ENSRNOG00000039902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LBH pAb (ATL-HPA034669) – 1 Found

Li, Yi; Liu, Huizhan; Barta, Cody L; Judge, Paul D; Zhao, Lidong; Zhang, Weiping J; Gong, Shusheng; Beisel, Kirk W; He, David Z Z. Transcription Factors Expressed in Mouse Cochlear Inner and Outer Hair Cells. Plos One. 11(3):e0151291.