Anti LASP1 pAb (ATL-HPA012072 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012072-25

Protein Description: LIM and SH3 protein 1
Gene Name: LASP1
Alternative Gene Name: Lasp-1, MLN50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038366: 91%, ENSRNOG00000004132: 92%
Entrez Gene ID: 3927
Uniprot ID: Q14847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKE
• Gene Sequence: ADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKE
• Gene ID - Mouse: ENSMUSG00000038366
• Gene ID - Rat: ENSRNOG00000004132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LASP1 pAb (ATL-HPA012072 w/enhanced validation) – 2 Found

Vanderheijden, Cas; Vaessen, Thomas; Yakkioui, Youssef; Riedl, Robert; Temel, Yasin; Hovinga, Koos; Hoogland, Govert. LIM and SH3 protein 1 (LASP1) differentiates malignant chordomas from less malignant chondrosarcomas. Journal Of Neuro-Oncology. 2022;158(1):81-88. 

Ngan, Elaine; Northey, Jason J; Brown, Claire M; Ursini-Siegel, Josie; Siegel, Peter M. A complex containing LPP and α-actinin mediates TGFβ-induced migration and invasion of ErbB2-expressing breast cancer cells. Journal Of Cell Science. 2013;126(Pt 9):1981-91.