Anti LARS2 pAb (ATL-HPA045450)

Atlas Antibodies

Catalog No.: ATL-HPA045450-25

Protein Description: leucyl-tRNA synthetase 2, mitochondrial
Gene Name: LARS2
Alternative Gene Name: KIAA0028, LEURS, MGC26121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035202: 87%, ENSRNOG00000004760: 88%
Entrez Gene ID: 23395
Uniprot ID: Q15031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVEKWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISD
• Gene Sequence: VIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVEKWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISD
• Gene ID - Mouse: ENSMUSG00000035202
• Gene ID - Rat: ENSRNOG00000004760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.