Anti LARP7 pAb (ATL-HPA026842)

Atlas Antibodies

Catalog No.:
ATL-HPA026842-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: La ribonucleoprotein domain family, member 7
Gene Name: LARP7
Alternative Gene Name: DKFZP564K112, HDCMA18P, PIP7S
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027968: 64%, ENSRNOG00000048989: 56%
Entrez Gene ID: 51574
Uniprot ID: Q4G0J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSGVPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHA
Gene Sequence DSGVPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGDTECHA
Gene ID - Mouse ENSMUSG00000027968
Gene ID - Rat ENSRNOG00000048989
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LARP7 pAb (ATL-HPA026842)
Datasheet Anti LARP7 pAb (ATL-HPA026842) Datasheet (External Link)
Vendor Page Anti LARP7 pAb (ATL-HPA026842) at Atlas Antibodies

Documents & Links for Anti LARP7 pAb (ATL-HPA026842)
Datasheet Anti LARP7 pAb (ATL-HPA026842) Datasheet (External Link)
Vendor Page Anti LARP7 pAb (ATL-HPA026842)