Anti LARP6 pAb (ATL-HPA049029)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049029-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LARP6
Alternative Gene Name: acheron, FLJ11196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034839: 90%, ENSRNOG00000012438: 86%
Entrez Gene ID: 55323
Uniprot ID: Q9BRS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA |
| Gene Sequence | NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA |
| Gene ID - Mouse | ENSMUSG00000034839 |
| Gene ID - Rat | ENSRNOG00000012438 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LARP6 pAb (ATL-HPA049029) | |
| Datasheet | Anti LARP6 pAb (ATL-HPA049029) Datasheet (External Link) |
| Vendor Page | Anti LARP6 pAb (ATL-HPA049029) at Atlas Antibodies |
| Documents & Links for Anti LARP6 pAb (ATL-HPA049029) | |
| Datasheet | Anti LARP6 pAb (ATL-HPA049029) Datasheet (External Link) |
| Vendor Page | Anti LARP6 pAb (ATL-HPA049029) |
| Citations for Anti LARP6 pAb (ATL-HPA049029) – 1 Found |
| Dermit, Maria; Dodel, Martin; Lee, Flora C Y; Azman, Muhammad S; Schwenzer, Hagen; Jones, J Louise; Blagden, Sarah P; Ule, Jernej; Mardakheh, Faraz K. Subcellular mRNA Localization Regulates Ribosome Biogenesis in Migrating Cells. Developmental Cell. 2020;55(3):298-313.e10. PubMed |