Anti LARP6 pAb (ATL-HPA049029)

Atlas Antibodies

Catalog No.:
ATL-HPA049029-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: La ribonucleoprotein domain family, member 6
Gene Name: LARP6
Alternative Gene Name: acheron, FLJ11196
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034839: 90%, ENSRNOG00000012438: 86%
Entrez Gene ID: 55323
Uniprot ID: Q9BRS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA
Gene Sequence NMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNKLSPSGHQNLFLSPNA
Gene ID - Mouse ENSMUSG00000034839
Gene ID - Rat ENSRNOG00000012438
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LARP6 pAb (ATL-HPA049029)
Datasheet Anti LARP6 pAb (ATL-HPA049029) Datasheet (External Link)
Vendor Page Anti LARP6 pAb (ATL-HPA049029) at Atlas Antibodies

Documents & Links for Anti LARP6 pAb (ATL-HPA049029)
Datasheet Anti LARP6 pAb (ATL-HPA049029) Datasheet (External Link)
Vendor Page Anti LARP6 pAb (ATL-HPA049029)
Citations for Anti LARP6 pAb (ATL-HPA049029) – 1 Found
Dermit, Maria; Dodel, Martin; Lee, Flora C Y; Azman, Muhammad S; Schwenzer, Hagen; Jones, J Louise; Blagden, Sarah P; Ule, Jernej; Mardakheh, Faraz K. Subcellular mRNA Localization Regulates Ribosome Biogenesis in Migrating Cells. Developmental Cell. 2020;55(3):298-313.e10.  PubMed