Anti LAPTM5 pAb (ATL-HPA051293)

Atlas Antibodies

Catalog No.:
ATL-HPA051293-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: lysosomal protein transmembrane 5
Gene Name: LAPTM5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028581: 69%, ENSRNOG00000011054: 66%
Entrez Gene ID: 7805
Uniprot ID: Q13571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP
Gene Sequence IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP
Gene ID - Mouse ENSMUSG00000028581
Gene ID - Rat ENSRNOG00000011054
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LAPTM5 pAb (ATL-HPA051293)
Datasheet Anti LAPTM5 pAb (ATL-HPA051293) Datasheet (External Link)
Vendor Page Anti LAPTM5 pAb (ATL-HPA051293) at Atlas Antibodies

Documents & Links for Anti LAPTM5 pAb (ATL-HPA051293)
Datasheet Anti LAPTM5 pAb (ATL-HPA051293) Datasheet (External Link)
Vendor Page Anti LAPTM5 pAb (ATL-HPA051293)