Anti LANCL3 pAb (ATL-HPA005470)

Atlas Antibodies

Catalog No.: ATL-HPA005470-25

Protein Description: LanC lantibiotic synthetase component C-like 3 (bacterial)
Gene Name: LANCL3
Alternative Gene Name: FLJ42925
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047344: 94%, ENSRNOG00000003756: 95%
Entrez Gene ID: 347404
Uniprot ID: Q6ZV70
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VAYMLYHVSQSPLFATARERYLRSAKRLIDACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVC
• Gene Sequence: VAYMLYHVSQSPLFATARERYLRSAKRLIDACARAEEWGEPDADTRAAFLLGGAGVYAVATLVYHALGRSDYVQPLGKFRALCAVC
• Gene ID - Mouse: ENSMUSG00000047344
• Gene ID - Rat: ENSRNOG00000003756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.