Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029535-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: LANCL2
Alternative Gene Name: GPR69B, TASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062190: 89%, ENSRNOG00000006810: 88%
Entrez Gene ID: 55915
Uniprot ID: Q9NS86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY |
| Gene Sequence | LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY |
| Gene ID - Mouse | ENSMUSG00000062190 |
| Gene ID - Rat | ENSRNOG00000006810 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation) | |
| Datasheet | Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation) | |
| Datasheet | Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation) |