Anti LANCL2 pAb (ATL-HPA029535 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029535-100

Protein Description: LanC lantibiotic synthetase component C-like 2 (bacterial)
Gene Name: LANCL2
Alternative Gene Name: GPR69B, TASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062190: 89%, ENSRNOG00000006810: 88%
Entrez Gene ID: 55915
Uniprot ID: Q9NS86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY
• Gene Sequence: LYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGY
• Gene ID - Mouse: ENSMUSG00000062190
• Gene ID - Rat: ENSRNOG00000006810
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.