Anti LANCL2 pAb (ATL-HPA019711)

Atlas Antibodies

Catalog No.:
ATL-HPA019711-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: LanC lantibiotic synthetase component C-like 2 (bacterial)
Gene Name: LANCL2
Alternative Gene Name: GPR69B, TASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062190: 93%, ENSRNOG00000006810: 93%
Entrez Gene ID: 55915
Uniprot ID: Q9NS86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY
Gene Sequence ALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDY
Gene ID - Mouse ENSMUSG00000062190
Gene ID - Rat ENSRNOG00000006810
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LANCL2 pAb (ATL-HPA019711)
Datasheet Anti LANCL2 pAb (ATL-HPA019711) Datasheet (External Link)
Vendor Page Anti LANCL2 pAb (ATL-HPA019711) at Atlas Antibodies

Documents & Links for Anti LANCL2 pAb (ATL-HPA019711)
Datasheet Anti LANCL2 pAb (ATL-HPA019711) Datasheet (External Link)
Vendor Page Anti LANCL2 pAb (ATL-HPA019711)