Anti LAMTOR2 pAb (ATL-HPA004126)

Atlas Antibodies

Catalog No.: ATL-HPA004126-25

Protein Description: late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
Gene Name: LAMTOR2
Alternative Gene Name: ENDAP, MAPBPIP, MAPKSP1AP, p14, Ragulator2, ROBLD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028062: 99%, ENSRNOG00000019908: 99%
Entrez Gene ID: 28956
Uniprot ID: Q9Y2Q5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
• Gene Sequence: RPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
• Gene ID - Mouse: ENSMUSG00000028062
• Gene ID - Rat: ENSRNOG00000019908
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.