Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051467-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LAMP3
Alternative Gene Name: CD208, DC-LAMP, DCLAMP, LAMP, TSC403
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041247: 52%, ENSRNOG00000022792: 46%
Entrez Gene ID: 27074
Uniprot ID: Q9UQV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT |
| Gene Sequence | SIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNAT |
| Gene ID - Mouse | ENSMUSG00000041247 |
| Gene ID - Rat | ENSRNOG00000022792 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) | |
| Datasheet | Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) | |
| Datasheet | Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) |
| Citations for Anti LAMP3 pAb (ATL-HPA051467 w/enhanced validation) – 1 Found |
| Delvecchio, Francesca R; Fincham, Rachel E A; Spear, Sarah; Clear, Andrew; Roy-Luzarraga, Marina; Balkwill, Frances R; Gribben, John G; Bombardieri, Michele; Hodivala-Dilke, Kairbaan; Capasso, Melania; Kocher, Hemant M. Pancreatic Cancer Chemotherapy Is Potentiated by Induction of Tertiary Lymphoid Structures in Mice. Cellular And Molecular Gastroenterology And Hepatology. 12(5):1543-1565. PubMed |