Anti LAMB3 pAb (ATL-HPA008069)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008069-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LAMB3
Alternative Gene Name: BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026639: 75%, ENSRNOG00000006025: 76%
Entrez Gene ID: 3914
Uniprot ID: Q13751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ |
| Gene Sequence | KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ |
| Gene ID - Mouse | ENSMUSG00000026639 |
| Gene ID - Rat | ENSRNOG00000006025 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LAMB3 pAb (ATL-HPA008069) | |
| Datasheet | Anti LAMB3 pAb (ATL-HPA008069) Datasheet (External Link) |
| Vendor Page | Anti LAMB3 pAb (ATL-HPA008069) at Atlas Antibodies |
| Documents & Links for Anti LAMB3 pAb (ATL-HPA008069) | |
| Datasheet | Anti LAMB3 pAb (ATL-HPA008069) Datasheet (External Link) |
| Vendor Page | Anti LAMB3 pAb (ATL-HPA008069) |
| Citations for Anti LAMB3 pAb (ATL-HPA008069) – 3 Found |
| Puram, Sidharth V; Tirosh, Itay; Parikh, Anuraag S; Patel, Anoop P; Yizhak, Keren; Gillespie, Shawn; Rodman, Christopher; Luo, Christina L; Mroz, Edmund A; Emerick, Kevin S; Deschler, Daniel G; Varvares, Mark A; Mylvaganam, Ravi; Rozenblatt-Rosen, Orit; Rocco, James W; Faquin, William C; Lin, Derrick T; Regev, Aviv; Bernstein, Bradley E. Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Head and Neck Cancer. Cell. 2017;171(7):1611-1624.e24. PubMed |
| Kinoshita, Takashi; Hanazawa, Toyoyuki; Nohata, Nijiro; Kikkawa, Naoko; Enokida, Hideki; Yoshino, Hirofumi; Yamasaki, Takeshi; Hidaka, Hideo; Nakagawa, Masayuki; Okamoto, Yoshitaka; Seki, Naohiko. Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma. Oncotarget. 2012;3(11):1386-400. PubMed |
| Yamamoto, Noriko; Kinoshita, Takashi; Nohata, Nijiro; Itesako, Toshihiko; Yoshino, Hirofumi; Enokida, Hideki; Nakagawa, Masayuki; Shozu, Makio; Seki, Naohiko. Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion by targeting focal adhesion pathways in cervical squamous cell carcinoma. International Journal Of Oncology. 2013;42(5):1523-32. PubMed |