Anti LAMB2 pAb (ATL-HPA001895)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001895-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LAMB2
Alternative Gene Name: LAMS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052911: 83%, ENSRNOG00000047768: 82%
Entrez Gene ID: 3913
Uniprot ID: P55268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG |
Gene Sequence | DLTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSQSAEAERRANTSALAVPSPVSNSASARHRTEALMDAQKEDFNSKHMANQRALGKLSAHTHTLSLTDINELVCGAPG |
Gene ID - Mouse | ENSMUSG00000052911 |
Gene ID - Rat | ENSRNOG00000047768 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LAMB2 pAb (ATL-HPA001895) | |
Datasheet | Anti LAMB2 pAb (ATL-HPA001895) Datasheet (External Link) |
Vendor Page | Anti LAMB2 pAb (ATL-HPA001895) at Atlas Antibodies |
Documents & Links for Anti LAMB2 pAb (ATL-HPA001895) | |
Datasheet | Anti LAMB2 pAb (ATL-HPA001895) Datasheet (External Link) |
Vendor Page | Anti LAMB2 pAb (ATL-HPA001895) |
Citations for Anti LAMB2 pAb (ATL-HPA001895) – 1 Found |
Chen, Huanhuan Joyce; Wei, Zhubo; Sun, Jian; Bhattacharya, Asmita; Savage, David J; Serda, Rita; Mackeyev, Yuri; Curley, Steven A; Bu, Pengcheng; Wang, Lihua; Chen, Shuibing; Cohen-Gould, Leona; Huang, Emina; Shen, Xiling; Lipkin, Steven M; Copeland, Neal G; Jenkins, Nancy A; Shuler, Michael L. A recellularized human colon model identifies cancer driver genes. Nature Biotechnology. 2016;34(8):845-51. PubMed |