Anti LAMB1 pAb (ATL-HPA004132 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004132-100

Protein Description: laminin, beta 1
Gene Name: LAMB1
Alternative Gene Name: CLM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002900: 96%, ENSRNOG00000005678: 96%
Entrez Gene ID: 3912
Uniprot ID: P07942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGG
• Gene Sequence: NQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGG
• Gene ID - Mouse: ENSMUSG00000002900
• Gene ID - Rat: ENSRNOG00000005678
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LAMB1 pAb (ATL-HPA004132 w/enhanced validation) – 1 Found

Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38.