Anti LAMB1 pAb (ATL-HPA004056)

Atlas Antibodies

Catalog No.:
ATL-HPA004056-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: laminin, beta 1
Gene Name: LAMB1
Alternative Gene Name: CLM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002900: 90%, ENSRNOG00000005678: 89%
Entrez Gene ID: 3912
Uniprot ID: P07942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Gene Sequence GPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEF
Gene ID - Mouse ENSMUSG00000002900
Gene ID - Rat ENSRNOG00000005678
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LAMB1 pAb (ATL-HPA004056)
Datasheet Anti LAMB1 pAb (ATL-HPA004056) Datasheet (External Link)
Vendor Page Anti LAMB1 pAb (ATL-HPA004056) at Atlas Antibodies

Documents & Links for Anti LAMB1 pAb (ATL-HPA004056)
Datasheet Anti LAMB1 pAb (ATL-HPA004056) Datasheet (External Link)
Vendor Page Anti LAMB1 pAb (ATL-HPA004056)
Citations for Anti LAMB1 pAb (ATL-HPA004056) – 1 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed