Anti LAMA3 pAb (ATL-HPA009309)

Atlas Antibodies

Catalog No.: ATL-HPA009309-25

Protein Description: laminin, alpha 3
Gene Name: LAMA3
Alternative Gene Name: BM600-150kDa, epiligrin, kalinin-165kDa, LAMNA, nicein-150kDa
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024421: 74%, ENSRNOG00000011300: 71%
Entrez Gene ID: 3909
Uniprot ID: Q16787
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
• Gene Sequence: LLNRIRTWQKTHQGENNGLANSIRDSLNEYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQLMEKSQKEYE
• Gene ID - Mouse: ENSMUSG00000024421
• Gene ID - Rat: ENSRNOG00000011300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LAMA3 pAb (ATL-HPA009309) – 2 Found

Kuhn, Elisabetta; Kurman, Robert J; Soslow, Robert A; Han, Guangming; Sehdev, Ann Smith; Morin, Patrick J; Wang, Tian-Li; Shih, Ie-Ming. The diagnostic and biological implications of laminin expression in serous tubal intraepithelial carcinoma. The American Journal Of Surgical Pathology. 2012;36(12):1826-34. 

Senyürek, Ilknur; Kempf, Wolfgang E; Klein, Gerd; Maurer, Andreas; Kalbacher, Hubert; Schäfer, Luisa; Wanke, Ines; Christ, Christina; Stevanovic, Stefan; Schaller, Martin; Rousselle, Patricia; Garbe, Claus; Biedermann, Tilo; Schittek, Birgit. Processing of laminin α chains generates peptides involved in wound healing and host defense. Journal Of Innate Immunity. 6(4):467-84.