Anti LAMA1 pAb (ATL-HPA032110)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032110-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LAMA1
Alternative Gene Name: LAMA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032796: 89%, ENSRNOG00000017237: 91%
Entrez Gene ID: 284217
Uniprot ID: P25391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS |
| Gene Sequence | TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS |
| Gene ID - Mouse | ENSMUSG00000032796 |
| Gene ID - Rat | ENSRNOG00000017237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LAMA1 pAb (ATL-HPA032110) | |
| Datasheet | Anti LAMA1 pAb (ATL-HPA032110) Datasheet (External Link) |
| Vendor Page | Anti LAMA1 pAb (ATL-HPA032110) at Atlas Antibodies |
| Documents & Links for Anti LAMA1 pAb (ATL-HPA032110) | |
| Datasheet | Anti LAMA1 pAb (ATL-HPA032110) Datasheet (External Link) |
| Vendor Page | Anti LAMA1 pAb (ATL-HPA032110) |