Anti LALBA pAb (ATL-HPA029856 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029856-25

Protein Description: lactalbumin, alpha-
Gene Name: LALBA
Alternative Gene Name: LYZL7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022991: 71%, ENSRNOG00000010811: 74%
Entrez Gene ID: 3906
Uniprot ID: P00709
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEK
• Gene Sequence: QVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEK
• Gene ID - Mouse: ENSMUSG00000022991
• Gene ID - Rat: ENSRNOG00000010811
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LALBA pAb (ATL-HPA029856 w/enhanced validation) – 2 Found

Tuohy, Vincent K; Jaini, Ritika; Johnson, Justin M; Loya, Matthew G; Wilk, Dennis; Downs-Kelly, Erinn; Mazumder, Suparna. Targeted Vaccination against Human α-Lactalbumin for Immunotherapy and Primary Immunoprevention of Triple Negative Breast Cancer. Cancers. 2016;8(6) 

Jaini, Ritika; Loya, Matthew G; Eng, Charis. Immunotherapeutic target expression on breast tumors can be amplified by hormone receptor antagonism: a novel strategy for enhancing efficacy of targeted immunotherapy. Oncotarget. 2017;8(20):32536-32549.