Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA013967-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LAG3
Alternative Gene Name: CD223
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030124: 69%, ENSRNOG00000021334: 64%
Entrez Gene ID: 3902
Uniprot ID: P18627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQ |
| Gene Sequence | LVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQ |
| Gene ID - Mouse | ENSMUSG00000030124 |
| Gene ID - Rat | ENSRNOG00000021334 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) | |
| Datasheet | Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) | |
| Datasheet | Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) |
| Citations for Anti LAG3 pAb (ATL-HPA013967 w/enhanced validation) – 2 Found |
| Davidsson, Sabina; Andren, Ove; Ohlson, Anna-Lena; Carlsson, Jessica; Andersson, Swen-Olof; Giunchi, Francesca; Rider, Jennifer R; Fiorentino, Michelangelo. FOXP3(+) regulatory T cells in normal prostate tissue, postatrophic hyperplasia, prostatic intraepithelial neoplasia, and tumor histological lesions in men with and without prostate cancer. The Prostate. 2018;78(1):40-47. PubMed |
| Al-Badran, Sara Sf; Grant, Lauren; Campo, Maejoy V; Inthagard, Jitwadee; Pennel, Kathryn; Quinn, Jean; Konanahalli, Prakash; Hayman, Liam; Horgan, Paul G; McMillan, Donald C; Roxburgh, Campbell Sd; Roseweir, Antonia; Park, James H; Edwards, Joanne. Relationship between immune checkpoint proteins, tumour microenvironment characteristics, and prognosis in primary operable colorectal cancer. The Journal Of Pathology. Clinical Research. 2021;7(2):121-134. PubMed |