Anti LACTBL1 pAb (ATL-HPA066810)

Atlas Antibodies

Catalog No.:
ATL-HPA066810-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: lactamase beta like 1
Gene Name: LACTBL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070683: 79%, ENSRNOG00000019243: 24%
Entrez Gene ID: 646262
Uniprot ID: A8MY62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNEYTMYRISSISKIFPVLMLYRLWEEGIVASLDDPLERYASTFTINNPLGLASAEQQGLMDGLEQVGPAPRPSPVTLRRMAS
Gene Sequence PNEYTMYRISSISKIFPVLMLYRLWEEGIVASLDDPLERYASTFTINNPLGLASAEQQGLMDGLEQVGPAPRPSPVTLRRMAS
Gene ID - Mouse ENSMUSG00000070683
Gene ID - Rat ENSRNOG00000019243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LACTBL1 pAb (ATL-HPA066810)
Datasheet Anti LACTBL1 pAb (ATL-HPA066810) Datasheet (External Link)
Vendor Page Anti LACTBL1 pAb (ATL-HPA066810) at Atlas Antibodies

Documents & Links for Anti LACTBL1 pAb (ATL-HPA066810)
Datasheet Anti LACTBL1 pAb (ATL-HPA066810) Datasheet (External Link)
Vendor Page Anti LACTBL1 pAb (ATL-HPA066810)