Anti LACE1 pAb (ATL-HPA030154)

Atlas Antibodies

Catalog No.: ATL-HPA030154-25

Protein Description: lactation elevated 1
Gene Name: LACE1
Alternative Gene Name: AFG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038302: 91%, ENSRNOG00000016156: 27%
Entrez Gene ID: 246269
Uniprot ID: Q8WV93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLT
• Gene Sequence: NGLQRANFVPFIAVLKEYCNTVQLDSGIDYRKRELPAAGKLYYLTSEADVEAVMDKLFDELAQKQNDLT
• Gene ID - Mouse: ENSMUSG00000038302
• Gene ID - Rat: ENSRNOG00000016156
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.