Anti L3MBTL4 pAb (ATL-HPA064194)

Atlas Antibodies

SKU:
ATL-HPA064194-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic  positivity in subset of glandular cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: l(3)mbt-like 4 (Drosophila)
Gene Name: L3MBTL4
Alternative Gene Name: FLJ35936, HsT1031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041565: 83%, ENSRNOG00000025273: 83%
Entrez Gene ID: 91133
Uniprot ID: Q8NA19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESD
Gene Sequence IGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESD
Gene ID - Mouse ENSMUSG00000041565
Gene ID - Rat ENSRNOG00000025273
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti L3MBTL4 pAb (ATL-HPA064194)
Datasheet Anti L3MBTL4 pAb (ATL-HPA064194) Datasheet (External Link)
Vendor Page Anti L3MBTL4 pAb (ATL-HPA064194) at Atlas Antibodies

Documents & Links for Anti L3MBTL4 pAb (ATL-HPA064194)
Datasheet Anti L3MBTL4 pAb (ATL-HPA064194) Datasheet (External Link)
Vendor Page Anti L3MBTL4 pAb (ATL-HPA064194)