Anti L3MBTL3 pAb (ATL-HPA053035)

Atlas Antibodies

Catalog No.:
ATL-HPA053035-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: l(3)mbt-like 3 (Drosophila)
Gene Name: L3MBTL3
Alternative Gene Name: KIAA1798
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039089: 83%, ENSRNOG00000011720: 80%
Entrez Gene ID: 84456
Uniprot ID: Q96JM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKK
Gene Sequence SEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKK
Gene ID - Mouse ENSMUSG00000039089
Gene ID - Rat ENSRNOG00000011720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti L3MBTL3 pAb (ATL-HPA053035)
Datasheet Anti L3MBTL3 pAb (ATL-HPA053035) Datasheet (External Link)
Vendor Page Anti L3MBTL3 pAb (ATL-HPA053035) at Atlas Antibodies

Documents & Links for Anti L3MBTL3 pAb (ATL-HPA053035)
Datasheet Anti L3MBTL3 pAb (ATL-HPA053035) Datasheet (External Link)
Vendor Page Anti L3MBTL3 pAb (ATL-HPA053035)