Anti L2HGDH pAb (ATL-HPA069708)

Atlas Antibodies

Catalog No.:
ATL-HPA069708-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: L-2-hydroxyglutarate dehydrogenase
Gene Name: L2HGDH
Alternative Gene Name: C14orf160, FLJ12618
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020988: 83%, ENSRNOG00000004857: 83%
Entrez Gene ID: 79944
Uniprot ID: Q9H9P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Gene Sequence ISDILRGPAGVRAQALDRDGNLVEDFVFDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Gene ID - Mouse ENSMUSG00000020988
Gene ID - Rat ENSRNOG00000004857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti L2HGDH pAb (ATL-HPA069708)
Datasheet Anti L2HGDH pAb (ATL-HPA069708) Datasheet (External Link)
Vendor Page Anti L2HGDH pAb (ATL-HPA069708) at Atlas Antibodies

Documents & Links for Anti L2HGDH pAb (ATL-HPA069708)
Datasheet Anti L2HGDH pAb (ATL-HPA069708) Datasheet (External Link)
Vendor Page Anti L2HGDH pAb (ATL-HPA069708)