Anti L1CAM pAb (ATL-HPA005830 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005830-25

Protein Description: L1 cell adhesion molecule
Gene Name: L1CAM
Alternative Gene Name: CD171, HSAS, HSAS1, MASA, MIC5, S10, SPG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031391: 75%, ENSRNOG00000061230: 75%
Entrez Gene ID: 3897
Uniprot ID: P32004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
• Gene Sequence: ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
• Gene ID - Mouse: ENSMUSG00000031391
• Gene ID - Rat: ENSRNOG00000061230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti L1CAM pAb (ATL-HPA005830 w/enhanced validation) – 3 Found

Brahmer, Alexandra; Neuberger, Elmo; Esch-Heisser, Leona; Haller, Nils; Jorgensen, Malene Moeller; Baek, Rikke; Möbius, Wiebke; Simon, Perikles; Krämer-Albers, Eva-Maria. Platelets, endothelial cells and leukocytes contribute to the exercise-triggered release of extracellular vesicles into the circulation. Journal Of Extracellular Vesicles. 8(1):1615820. 

Jørgensen, Malene Møller; Bæk, Rikke; Varming, Kim. Potentials and capabilities of the Extracellular Vesicle (EV) Array. Journal Of Extracellular Vesicles. 4( 25862471):26048. 

Cave, Donatella Delle; Hernando-Momblona, Xavier; Sevillano, Marta; Minchiotti, Gabriella; Lonardo, Enza. Nodal-induced L1CAM/CXCR4 subpopulation sustains tumor growth and metastasis in colorectal cancer derived organoids. Theranostics. 11(12):5686-5699.