Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003178-25

Protein Description: kinectin 1 (kinesin receptor)
Gene Name: KTN1
Alternative Gene Name: CG1, KIAA0004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021843: 80%, ENSRNOG00000012255: 75%
Entrez Gene ID: 3895
Uniprot ID: Q86UP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ
• Gene Sequence: ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ
• Gene ID - Mouse: ENSMUSG00000021843
• Gene ID - Rat: ENSRNOG00000012255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation) – 4 Found

van Dijk, Karin D; Berendse, Henk W; Drukarch, Benjamin; Fratantoni, Silvina A; Pham, Thang V; Piersma, Sander R; Huisman, Evelien; Brevé, John J P; Groenewegen, Henk J; Jimenez, Connie R; van de Berg, Wilma D J. The proteome of the locus ceruleus in Parkinson's disease: relevance to pathogenesis. Brain Pathology (Zurich, Switzerland). 2012;22(4):485-98. 

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Carter, Rachel J; Milani, Mateus; Beckett, Alison J; Liu, Shiyu; Prior, Ian A; Cohen, Gerald M; Varadarajan, Shankar. Novel roles of RTN4 and CLIMP-63 in regulating mitochondrial structure, bioenergetics and apoptosis. Cell Death & Disease. 2022;13(5):436. 

Bhadra, Pratiti; Schorr, Stefan; Lerner, Monika; Nguyen, Duy; Dudek, Johanna; Förster, Friedrich; Helms, Volkhard; Lang, Sven; Zimmermann, Richard. Quantitative Proteomics and Differential Protein Abundance Analysis after Depletion of Putative mRNA Receptors in the ER Membrane of Human Cells Identifies Novel Aspects of mRNA Targeting to the ER. Molecules (Basel, Switzerland). 2021;26(12)