Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003178-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: kinectin 1 (kinesin receptor)
Gene Name: KTN1
Alternative Gene Name: CG1, KIAA0004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021843: 80%, ENSRNOG00000012255: 75%
Entrez Gene ID: 3895
Uniprot ID: Q86UP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ
Gene Sequence ETLMVPSKRQEALPLHQETKQESGSGKKKASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQ
Gene ID - Mouse ENSMUSG00000021843
Gene ID - Rat ENSRNOG00000012255
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation)
Datasheet Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation)
Datasheet Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation)
Citations for Anti KTN1 pAb (ATL-HPA003178 w/enhanced validation) – 4 Found
van Dijk, Karin D; Berendse, Henk W; Drukarch, Benjamin; Fratantoni, Silvina A; Pham, Thang V; Piersma, Sander R; Huisman, Evelien; Brevé, John J P; Groenewegen, Henk J; Jimenez, Connie R; van de Berg, Wilma D J. The proteome of the locus ceruleus in Parkinson's disease: relevance to pathogenesis. Brain Pathology (Zurich, Switzerland). 2012;22(4):485-98.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed
Carter, Rachel J; Milani, Mateus; Beckett, Alison J; Liu, Shiyu; Prior, Ian A; Cohen, Gerald M; Varadarajan, Shankar. Novel roles of RTN4 and CLIMP-63 in regulating mitochondrial structure, bioenergetics and apoptosis. Cell Death & Disease. 2022;13(5):436.  PubMed
Bhadra, Pratiti; Schorr, Stefan; Lerner, Monika; Nguyen, Duy; Dudek, Johanna; Förster, Friedrich; Helms, Volkhard; Lang, Sven; Zimmermann, Richard. Quantitative Proteomics and Differential Protein Abundance Analysis after Depletion of Putative mRNA Receptors in the ER Membrane of Human Cells Identifies Novel Aspects of mRNA Targeting to the ER. Molecules (Basel, Switzerland). 2021;26(12)  PubMed