Anti KRTAP16-1 pAb (ATL-HPA070954)

Atlas Antibodies

Catalog No.:
ATL-HPA070954-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: keratin associated protein 16-1
Gene Name: KRTAP16-1
Alternative Gene Name: KAP16.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078253: 61%, ENSRNOG00000061192: 62%
Entrez Gene ID: 100505753
Uniprot ID: A8MUX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACVTSYSCRPVYFRPSCTESDSCKRDCKKSTSSQLDCVDTTPCKVDVSEEAPCQPTEAKPISPTTR
Gene Sequence ACVTSYSCRPVYFRPSCTESDSCKRDCKKSTSSQLDCVDTTPCKVDVSEEAPCQPTEAKPISPTTR
Gene ID - Mouse ENSMUSG00000078253
Gene ID - Rat ENSRNOG00000061192
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRTAP16-1 pAb (ATL-HPA070954)
Datasheet Anti KRTAP16-1 pAb (ATL-HPA070954) Datasheet (External Link)
Vendor Page Anti KRTAP16-1 pAb (ATL-HPA070954) at Atlas Antibodies

Documents & Links for Anti KRTAP16-1 pAb (ATL-HPA070954)
Datasheet Anti KRTAP16-1 pAb (ATL-HPA070954) Datasheet (External Link)
Vendor Page Anti KRTAP16-1 pAb (ATL-HPA070954)