Anti KRT76 pAb (ATL-HPA019696)

Atlas Antibodies

Catalog No.: ATL-HPA019696-25

Protein Description: keratin 76
Gene Name: KRT76
Alternative Gene Name: HUMCYT2A, KRT2B, KRT2P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075402: 82%, ENSRNOG00000031785: 81%
Entrez Gene ID: 51350
Uniprot ID: Q01546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK
• Gene Sequence: LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK
• Gene ID - Mouse: ENSMUSG00000075402
• Gene ID - Rat: ENSRNOG00000031785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KRT76 pAb (ATL-HPA019696) – 2 Found

Ambatipudi, Srikant; Bhosale, Priyanka G; Heath, Emma; Pandey, Manishkumar; Kumar, Gaurav; Kane, Shubhada; Patil, Asawari; Maru, Girish B; Desai, Rajiv S; Watt, Fiona M; Mahimkar, Manoj B. Downregulation of keratin 76 expression during oral carcinogenesis of human, hamster and mouse. Plos One. 8(7):e70688. 

DiTommaso, Tia; Cottle, Denny L; Pearson, Helen B; Schlüter, Holger; Kaur, Pritinder; Humbert, Patrick O; Smyth, Ian M. Keratin 76 is required for tight junction function and maintenance of the skin barrier. Plos Genetics. 2014;10(10):e1004706.