Anti KRT74 pAb (ATL-HPA048596)

Atlas Antibodies

Catalog No.:
ATL-HPA048596-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: keratin 74
Gene Name: KRT74
Alternative Gene Name: K6IRS4, KRT5C, KRT6IRS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067596: 39%, ENSRNOG00000013837: 36%
Entrez Gene ID: 121391
Uniprot ID: Q7RTS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISVISSSSYSYHHPSSAGVDLGASAVAGSSGSTQSGQTKTTEARGGDLKDTQGKSTPASIPARKATR
Gene Sequence ISVISSSSYSYHHPSSAGVDLGASAVAGSSGSTQSGQTKTTEARGGDLKDTQGKSTPASIPARKATR
Gene ID - Mouse ENSMUSG00000067596
Gene ID - Rat ENSRNOG00000013837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT74 pAb (ATL-HPA048596)
Datasheet Anti KRT74 pAb (ATL-HPA048596) Datasheet (External Link)
Vendor Page Anti KRT74 pAb (ATL-HPA048596) at Atlas Antibodies

Documents & Links for Anti KRT74 pAb (ATL-HPA048596)
Datasheet Anti KRT74 pAb (ATL-HPA048596) Datasheet (External Link)
Vendor Page Anti KRT74 pAb (ATL-HPA048596)