Anti KRT71 pAb (ATL-HPA049404)

Atlas Antibodies

Catalog No.:
ATL-HPA049404-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: keratin 71
Gene Name: KRT71
Alternative Gene Name: K6IRS1, KRT6IRS, KRT6IRS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051879: 83%, ENSRNOG00000049495: 82%
Entrez Gene ID: 112802
Uniprot ID: Q3SY84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFPSPVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR
Gene Sequence EFPSPVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR
Gene ID - Mouse ENSMUSG00000051879
Gene ID - Rat ENSRNOG00000049495
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT71 pAb (ATL-HPA049404)
Datasheet Anti KRT71 pAb (ATL-HPA049404) Datasheet (External Link)
Vendor Page Anti KRT71 pAb (ATL-HPA049404) at Atlas Antibodies

Documents & Links for Anti KRT71 pAb (ATL-HPA049404)
Datasheet Anti KRT71 pAb (ATL-HPA049404) Datasheet (External Link)
Vendor Page Anti KRT71 pAb (ATL-HPA049404)