Anti KRT71 pAb (ATL-HPA049404)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049404-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: KRT71
Alternative Gene Name: K6IRS1, KRT6IRS, KRT6IRS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051879: 83%, ENSRNOG00000049495: 82%
Entrez Gene ID: 112802
Uniprot ID: Q3SY84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EFPSPVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR |
Gene Sequence | EFPSPVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR |
Gene ID - Mouse | ENSMUSG00000051879 |
Gene ID - Rat | ENSRNOG00000049495 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KRT71 pAb (ATL-HPA049404) | |
Datasheet | Anti KRT71 pAb (ATL-HPA049404) Datasheet (External Link) |
Vendor Page | Anti KRT71 pAb (ATL-HPA049404) at Atlas Antibodies |
Documents & Links for Anti KRT71 pAb (ATL-HPA049404) | |
Datasheet | Anti KRT71 pAb (ATL-HPA049404) Datasheet (External Link) |
Vendor Page | Anti KRT71 pAb (ATL-HPA049404) |