Anti KRT7 pAb (ATL-HPA007272 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007272-25

Protein Description: keratin 7
Gene Name: KRT7
Alternative Gene Name: CK7, K2C7, K7, SCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023039: 90%, ENSRNOG00000008057: 90%
Entrez Gene ID: 3855
Uniprot ID: P08729
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
• Gene Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD
• Gene ID - Mouse: ENSMUSG00000023039
• Gene ID - Rat: ENSRNOG00000008057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KRT7 pAb (ATL-HPA007272 w/enhanced validation) – 2 Found

Mervai, Zsolt; Egedi, Krisztina; Kovalszky, Ilona; Baghy, Kornélia. Diethylnitrosamine induces lung adenocarcinoma in FVB/N mouse. Bmc Cancer. 2018;18(1):157. 

Halin Bergström, Sofia; Lundholm, Marie; Nordstrand, Annika; Bergh, Anders. Rat prostate tumors induce DNA synthesis in remote organs. Scientific Reports. 2022;12(1):7908.