Anti KRT28 pAb (ATL-HPA066890)

Atlas Antibodies

Catalog No.:
ATL-HPA066890-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: keratin 28, type I
Gene Name: KRT28
Alternative Gene Name: KRT25D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055937: 57%, ENSRNOG00000011846: 60%
Entrez Gene ID: 162605
Uniprot ID: Q7Z3Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCSLGTLQFCIDKVNISQNTMSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEG
Gene Sequence FCSLGTLQFCIDKVNISQNTMSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEG
Gene ID - Mouse ENSMUSG00000055937
Gene ID - Rat ENSRNOG00000011846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT28 pAb (ATL-HPA066890)
Datasheet Anti KRT28 pAb (ATL-HPA066890) Datasheet (External Link)
Vendor Page Anti KRT28 pAb (ATL-HPA066890) at Atlas Antibodies

Documents & Links for Anti KRT28 pAb (ATL-HPA066890)
Datasheet Anti KRT28 pAb (ATL-HPA066890) Datasheet (External Link)
Vendor Page Anti KRT28 pAb (ATL-HPA066890)