Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053977-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: keratin 25
Gene Name: KRT25
Alternative Gene Name: KRT25A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035831: 90%, ENSRNOG00000011196: 87%
Entrez Gene ID: 147183
Uniprot ID: Q7Z3Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN
Gene Sequence TYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN
Gene ID - Mouse ENSMUSG00000035831
Gene ID - Rat ENSRNOG00000011196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation)
Datasheet Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation)
Datasheet Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT25 pAb (ATL-HPA053977 w/enhanced validation)