Anti KRT222 pAb (ATL-HPA069774)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069774-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: KRT222
Alternative Gene Name: KA21, KRT222P, MGC45562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035849: 94%, ENSRNOG00000010839: 94%
Entrez Gene ID: 125113
Uniprot ID: Q8N1A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDEVIKEWEGSFFKDNPRLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPST |
Gene Sequence | VDEVIKEWEGSFFKDNPRLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPST |
Gene ID - Mouse | ENSMUSG00000035849 |
Gene ID - Rat | ENSRNOG00000010839 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti KRT222 pAb (ATL-HPA069774) | |
Datasheet | Anti KRT222 pAb (ATL-HPA069774) Datasheet (External Link) |
Vendor Page | Anti KRT222 pAb (ATL-HPA069774) at Atlas Antibodies |
Documents & Links for Anti KRT222 pAb (ATL-HPA069774) | |
Datasheet | Anti KRT222 pAb (ATL-HPA069774) Datasheet (External Link) |
Vendor Page | Anti KRT222 pAb (ATL-HPA069774) |