Anti KRT222 pAb (ATL-HPA068724)

Atlas Antibodies

Catalog No.: ATL-HPA068724-25

Protein Description: keratin 222
Gene Name: KRT222
Alternative Gene Name: KA21, KRT222P, MGC45562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035849: 87%, ENSRNOG00000010839: 91%
Entrez Gene ID: 125113
Uniprot ID: Q8N1A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKMRLEQ
• Gene Sequence: NSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKMRLEQ
• Gene ID - Mouse: ENSMUSG00000035849
• Gene ID - Rat: ENSRNOG00000010839
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.