Anti KRT222 pAb (ATL-HPA068724)

Atlas Antibodies

Catalog No.:
ATL-HPA068724-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: keratin 222
Gene Name: KRT222
Alternative Gene Name: KA21, KRT222P, MGC45562
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035849: 87%, ENSRNOG00000010839: 91%
Entrez Gene ID: 125113
Uniprot ID: Q8N1A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKMRLEQ
Gene Sequence NSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQEHEMLLNTKMRLEQ
Gene ID - Mouse ENSMUSG00000035849
Gene ID - Rat ENSRNOG00000010839
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT222 pAb (ATL-HPA068724)
Datasheet Anti KRT222 pAb (ATL-HPA068724) Datasheet (External Link)
Vendor Page Anti KRT222 pAb (ATL-HPA068724) at Atlas Antibodies

Documents & Links for Anti KRT222 pAb (ATL-HPA068724)
Datasheet Anti KRT222 pAb (ATL-HPA068724) Datasheet (External Link)
Vendor Page Anti KRT222 pAb (ATL-HPA068724)