Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA055835-25

Protein Description: keratin 12, type I
Gene Name: KRT12
Alternative Gene Name: K12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020912: 63%, ENSRNOG00000011986: 72%
Entrez Gene ID: 3859
Uniprot ID: Q99456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK
• Gene Sequence: QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK
• Gene ID - Mouse: ENSMUSG00000020912
• Gene ID - Rat: ENSRNOG00000011986
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.