Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055835-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: keratin 12, type I
Gene Name: KRT12
Alternative Gene Name: K12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020912: 63%, ENSRNOG00000011986: 72%
Entrez Gene ID: 3859
Uniprot ID: Q99456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK
Gene Sequence QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK
Gene ID - Mouse ENSMUSG00000020912
Gene ID - Rat ENSRNOG00000011986
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation)
Datasheet Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation)
Datasheet Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KRT12 pAb (ATL-HPA055835 w/enhanced validation)