Anti KRR1 pAb (ATL-HPA051690)

Atlas Antibodies

Catalog No.:
ATL-HPA051690-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KRR1, small subunit (SSU) processome component, homolog (yeast)
Gene Name: KRR1
Alternative Gene Name: HRB2, RIP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063334: 98%, ENSRNOG00000004035: 97%
Entrez Gene ID: 11103
Uniprot ID: Q13601
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELA
Gene Sequence SAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELA
Gene ID - Mouse ENSMUSG00000063334
Gene ID - Rat ENSRNOG00000004035
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRR1 pAb (ATL-HPA051690)
Datasheet Anti KRR1 pAb (ATL-HPA051690) Datasheet (External Link)
Vendor Page Anti KRR1 pAb (ATL-HPA051690) at Atlas Antibodies

Documents & Links for Anti KRR1 pAb (ATL-HPA051690)
Datasheet Anti KRR1 pAb (ATL-HPA051690) Datasheet (External Link)
Vendor Page Anti KRR1 pAb (ATL-HPA051690)