Anti KRBA2 pAb (ATL-HPA022849)

Atlas Antibodies

Catalog No.:
ATL-HPA022849-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: KRAB-A domain containing 2
Gene Name: KRBA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027889: 24%, ENSRNOG00000021091: 25%
Entrez Gene ID: 124751
Uniprot ID: Q6ZNG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSL
Gene Sequence SVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGSLEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSL
Gene ID - Mouse ENSMUSG00000027889
Gene ID - Rat ENSRNOG00000021091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KRBA2 pAb (ATL-HPA022849)
Datasheet Anti KRBA2 pAb (ATL-HPA022849) Datasheet (External Link)
Vendor Page Anti KRBA2 pAb (ATL-HPA022849) at Atlas Antibodies

Documents & Links for Anti KRBA2 pAb (ATL-HPA022849)
Datasheet Anti KRBA2 pAb (ATL-HPA022849) Datasheet (External Link)
Vendor Page Anti KRBA2 pAb (ATL-HPA022849)