Anti KRAS pAb (ATL-HPA049830)

Atlas Antibodies

Catalog No.: ATL-HPA049830-25

Protein Description: Kirsten rat sarcoma viral oncogene homolog
Gene Name: KRAS
Alternative Gene Name: KRAS1, KRAS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030265: 100%, ENSRNOG00000009338: 100%
Entrez Gene ID: 3845
Uniprot ID: P01116
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
• Gene Sequence: EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
• Gene ID - Mouse: ENSMUSG00000030265
• Gene ID - Rat: ENSRNOG00000009338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KRAS pAb (ATL-HPA049830) – 1 Found

Herrera-Pulido, Jehison Alirio; Guerrero, Orlando Ricaurte; Forero, Jinneth Acosta; Moreno-Acosta, Pablo; Romero-Rojas, Alfredo; Sanabria, Carolina; Hernández, Gustavo; Serrano, Martha Lucía. KRAS Promoter Methylation Status and miR-18a-3p and miR-143 Expression in Patients With Wild-type KRAS Gene in Colorectal Cancer. Cancer Diagnosis & Prognosis. 2022;2(5):576-584.