Anti KPNA6 pAb (ATL-HPA018863)

Atlas Antibodies

Catalog No.:
ATL-HPA018863-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: karyopherin alpha 6 (importin alpha 7)
Gene Name: KPNA6
Alternative Gene Name: FLJ11249, IPOA7, KPNA7, MGC17918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003731: 100%, ENSRNOG00000000127: 100%
Entrez Gene ID: 23633
Uniprot ID: O60684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Gene Sequence RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Gene ID - Mouse ENSMUSG00000003731
Gene ID - Rat ENSRNOG00000000127
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KPNA6 pAb (ATL-HPA018863)
Datasheet Anti KPNA6 pAb (ATL-HPA018863) Datasheet (External Link)
Vendor Page Anti KPNA6 pAb (ATL-HPA018863) at Atlas Antibodies

Documents & Links for Anti KPNA6 pAb (ATL-HPA018863)
Datasheet Anti KPNA6 pAb (ATL-HPA018863) Datasheet (External Link)
Vendor Page Anti KPNA6 pAb (ATL-HPA018863)