Anti KPNA3 pAb (ATL-HPA077643)

Atlas Antibodies

Catalog No.:
ATL-HPA077643-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: karyopherin subunit alpha 3
Gene Name: KPNA3
Alternative Gene Name: hSRP1, IPOA4, SRP1gamma, SRP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021929: 100%, ENSRNOG00000014945: 100%
Entrez Gene ID: 3839
Uniprot ID: O00505
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKRNVPQEESLEDSDVDADFKAQNVTLEAILQ
Gene Sequence KKRNVPQEESLEDSDVDADFKAQNVTLEAILQ
Gene ID - Mouse ENSMUSG00000021929
Gene ID - Rat ENSRNOG00000014945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KPNA3 pAb (ATL-HPA077643)
Datasheet Anti KPNA3 pAb (ATL-HPA077643) Datasheet (External Link)
Vendor Page Anti KPNA3 pAb (ATL-HPA077643) at Atlas Antibodies

Documents & Links for Anti KPNA3 pAb (ATL-HPA077643)
Datasheet Anti KPNA3 pAb (ATL-HPA077643) Datasheet (External Link)
Vendor Page Anti KPNA3 pAb (ATL-HPA077643)