Anti KPNA1 pAb (ATL-HPA063426)

Atlas Antibodies

SKU:
ATL-HPA063426-100
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: karyopherin alpha 1 (importin alpha 5)
Gene Name: KPNA1
Alternative Gene Name: IPOA5, NPI-1, RCH2, SRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022905: 97%, ENSRNOG00000051711: 97%
Entrez Gene ID: 3836
Uniprot ID: P52294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFKRRNVATAEEETEEEVMSDGGFHEAQISNM
Gene Sequence LFKRRNVATAEEETEEEVMSDGGFHEAQISNM
Gene ID - Mouse ENSMUSG00000022905
Gene ID - Rat ENSRNOG00000051711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KPNA1 pAb (ATL-HPA063426)
Datasheet Anti KPNA1 pAb (ATL-HPA063426) Datasheet (External Link)
Vendor Page Anti KPNA1 pAb (ATL-HPA063426) at Atlas Antibodies

Documents & Links for Anti KPNA1 pAb (ATL-HPA063426)
Datasheet Anti KPNA1 pAb (ATL-HPA063426) Datasheet (External Link)
Vendor Page Anti KPNA1 pAb (ATL-HPA063426)