Anti KNOP1 pAb (ATL-HPA066169)

Atlas Antibodies

Catalog No.:
ATL-HPA066169-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lysine-rich nucleolar protein 1
Gene Name: KNOP1
Alternative Gene Name: 101F10.1, C16orf88, FAM191A, TSG118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030980: 71%, ENSRNOG00000046147: 86%
Entrez Gene ID: 400506
Uniprot ID: Q1ED39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDT
Gene Sequence KKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDT
Gene ID - Mouse ENSMUSG00000030980
Gene ID - Rat ENSRNOG00000046147
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KNOP1 pAb (ATL-HPA066169)
Datasheet Anti KNOP1 pAb (ATL-HPA066169) Datasheet (External Link)
Vendor Page Anti KNOP1 pAb (ATL-HPA066169) at Atlas Antibodies

Documents & Links for Anti KNOP1 pAb (ATL-HPA066169)
Datasheet Anti KNOP1 pAb (ATL-HPA066169) Datasheet (External Link)
Vendor Page Anti KNOP1 pAb (ATL-HPA066169)