Anti KMT5C pAb (ATL-HPA052294)

Atlas Antibodies

Catalog No.: ATL-HPA052294-25

Protein Description: lysine methyltransferase 5C
Gene Name: KMT5C
Alternative Gene Name: MGC2705, SUV420H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059851: 84%, ENSRNOG00000017508: 86%
Entrez Gene ID: 84787
Uniprot ID: Q86Y97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG
• Gene Sequence: EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG
• Gene ID - Mouse: ENSMUSG00000059851
• Gene ID - Rat: ENSRNOG00000017508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti KMT5C pAb (ATL-HPA052294) – 1 Found

Viotti, Manuel; Wilson, Catherine; McCleland, Mark; Koeppen, Hartmut; Haley, Benjamin; Jhunjhunwala, Suchit; Klijn, Christiaan; Modrusan, Zora; Arnott, David; Classon, Marie; Stephan, Jean-Philippe; Mellman, Ira. SUV420H2 is an epigenetic regulator of epithelial/mesenchymal states in pancreatic cancer. The Journal Of Cell Biology. 2018;217(2):763-777.